Protein Info for BWI76_RS00140 in Klebsiella michiganensis M5al

Annotation: phosphate transport system regulator PhoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 13 to 221 (209 residues), 243.1 bits, see alignment E=1.2e-76 PF01895: PhoU" amino acids 26 to 112 (87 residues), 83.7 bits, see alignment E=4.8e-28 amino acids 129 to 213 (85 residues), 71.8 bits, see alignment E=2.7e-24

Best Hits

Swiss-Prot: 98% identical to PHOU_ENTCL: Phosphate-specific transport system accessory protein PhoU (phoU) from Enterobacter cloacae

KEGG orthology group: K02039, phosphate transport system protein (inferred from 97% identity to ent:Ent638_4141)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVD1 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS00140 phosphate transport system regulator PhoU (Klebsiella michiganensis M5al)
MDNLNLNKHISGQFNAELEYIRTQVMTMGGLVEQQLSDAITAMHNQDSELAKRVIDGDKQ
VNMMEVAIDEACVRIIAKRQPTASDLRLVMAIIKTIAELERIGDVADKICRTALEKFSQQ
HQPLLVSLESLGRHTVQMLHDVLDAFARMDLDEAVRIYREDKKVDQEYEGIVRQLMTYMM
EDSRTIPSVLTALFCARSIERIGDRCQNICEYIFYFVKGQDFRHVGGDELDKLLAGKDPK
E