Protein Info for BWI76_RS00130 in Klebsiella michiganensis M5al

Annotation: LamB type porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF11471: Sugarporin_N" amino acids 29 to 57 (29 residues), 40.6 bits, see alignment (E = 2.4e-14) PF02264: LamB" amino acids 130 to 548 (419 residues), 294 bits, see alignment E=3.3e-91

Best Hits

Swiss-Prot: 83% identical to BGLH_ECOL6: Putative outer membrane porin BglH (bglH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_07110)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVD6 at UniProt or InterPro

Protein Sequence (548 amino acids)

>BWI76_RS00130 LamB type porin (Klebsiella michiganensis M5al)
MFKRNLITSAIIIMAPIAYSSHAMAASLTVEQRLELLEKALKDTQSELKKYKDEEKARNQ
IWVANTQPGGNKTSAARQAVSPPAPARAAQKPAAVLVKNEQPAANGESIYSSMTMKDFSQ
FVKDEIGFSYNGYYRSGWGTASHGSPKSWAIGSLGRFGNEYSGWFDLQLKQRVYQEGNKR
VDAIVMLDGNVGQQYSSGWFGDNAGGENYMQFSDMYVNTKGFLPFAPEADFWVGKHGAPK
IEIQMLDWKTQRTDAAAGVGLENWKVGAGKFDIALVREDVDDYNRTLTKSQQLNTNTIDI
RYKEIPLWDKASLMVTGRYVAANQSSSEKYNEGNNGYYEWKDTWMAGTSLTQKFDNGGFN
EFSFLLANNSIASSFSRYAGSSPYTTFNGRYYGDHTNGTAVRLTSQGETYLSDNIIMANA
IVYSFGNDIYSYETGAHSDFESIRAVVRPAWIWDKYNQTGVELGYFKQQNKDITGKKYNE
SGYKTTLFHTFKVNTSMLTSRPEIRFYATYIKAKDIDLDKAANSNTSSIFEDGKNDQFAV
GAQAEIWW