Protein Info for BWI76_RS00110 in Klebsiella michiganensis M5al

Annotation: adenine permease PurP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 388 to 413 (26 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 32 to 405 (374 residues), 141.6 bits, see alignment E=1.5e-45

Best Hits

Swiss-Prot: 95% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 98% identity to kpe:KPK_5558)

MetaCyc: 95% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVG4 at UniProt or InterPro

Protein Sequence (446 amino acids)

>BWI76_RS00110 adenine permease PurP (Klebsiella michiganensis M5al)
MMSQQQTSQSSGQGLLERVFKLREHGTTARTEAIAGFTTFLTMVYIVFVNPQILGVAGMD
TSAVFVTTCLIAAFGSIMMGLFANLPVALAPAMGLNAFFAFVVVQAMGLPWQVGMGAIFW
GAVGLLLLTIFRVRYWMIANIPVSLRIGITSGIGLFIGMMGLKNAGVIVANPETLVSIGN
LTSHSVLLGILGFFIIAILASRNIHAAVLVSIVVTTLLGWMLGDVHYTGIVSMPPSVTTV
IGHVDLAGSLNLGLAGVIFSFMLVNLFDSSGTLIGVTDKAGLADAQGKFPRMKQALFVDS
VSSVAGSFIGTSSVTAYIESSSGVSVGGRTGLTAVVVGLLFLLVIFLSPLAGMVPAYAAA
GALIYVGVLMTSSLARVKWDDLTESVPAFITAVMMPFSFSITEGIALGFISYCVMKIGTG
RLRDLSPCVIVVSLLFVLKIVFIDAH