Protein Info for BWI76_RS00105 in Klebsiella michiganensis M5al

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 6 to 148 (143 residues), 147.9 bits, E=1.8e-47
• PF02525: Flavodoxin_2
  • amino acids 48 to 117 (70 residues), 33 bits, E=5.2e-12

Best Hits

Swiss-Prot: 86% identical to CHRR_ECO57: Quinone reductase (chrR) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 92% identity to cro:ROD_40201)

MetaCyc: 86% identical to quinone reductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]; RXN0-3381 [EC: 1.6.5.2]

Predicted SEED Role

"FIG00553873: hypothetical protein"

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

See A0A285AVC8 at UniProt or InterPro

Protein Sequence (188 amino acids)

>BWI76_RS00105 NAD(P)H-dependent oxidoreductase (Klebsiella michiganensis M5al)
MSDTLKVVTLLGSLRKGSFNAMVARTLPGIAPAGMAVSALPSIGDIPLYDADVQQEEGFP
QSVQDIAQQIREADGVVIVTPEYNYSVPGGLKNAIDWLSRLPEQPLAGKPVLIQTSSMGA
IGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQEGKVVDQSTLDHLSGQLSAFA
EYIQRVKA