Protein Info for BWI76_RS00075 in Klebsiella michiganensis M5al

Annotation: N-acetylmannosamine-6-phosphate 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to NANE_SALA4: Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE) from Salmonella agona (strain SL483)

KEGG orthology group: K01788, N-acylglucosamine-6-phosphate 2-epimerase [EC: 5.1.3.9] (inferred from 72% identity to set:SEN3170)

MetaCyc: 70% identical to probable N-acetylmannosamine-6-phosphate 2-epimerase (Escherichia coli K-12 substr. MG1655)
N-acylglucosamine-6-phosphate 2-epimerase. [EC: 5.1.3.9]

Predicted SEED Role

"N-acetylmannosamine-6-phosphate 2-epimerase (EC 5.1.3.9)" in subsystem Sialic Acid Metabolism (EC 5.1.3.9)

MetaCyc Pathways

superpathway of N-acetylneuraminate degradation (22/22 steps found)
superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (6/6 steps found)
N-acetylneuraminate and N-acetylmannosamine degradation I (4/4 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVA6 at UniProt or InterPro

Protein Sequence (229 amino acids)

>BWI76_RS00075 N-acetylmannosamine-6-phosphate 2-epimerase (Klebsiella michiganensis M5al)
MSLFDTLDVKVKELGGLIVSCQPVPGSPLDKPEIVAAMALAAVKTGAVAVRIEGINNLKA
TRELISVPIIGIIKRDLPDSPVRITPFLEDVDALAQAGADIIAFDGTDRPRPASVKATIE
RIHQQGCVAMADCSNLEDGTRCHALGAEIIGTTLSGYTTEAVPNEPDFPLVQALSAKGYR
VIAEGRFNSPALAAQAIKQGAWAVTVGSAITRIEHICQWYRDALAEVAL