Protein Info for BWI76_RS00065 in Klebsiella michiganensis M5al

Annotation: MurR/RpiR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF01418: HTH_6" amino acids 13 to 85 (73 residues), 74.7 bits, see alignment E=7e-25 PF01380: SIS" amino acids 140 to 268 (129 residues), 74.1 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 54% identical to Y143_HAEIN: Uncharacterized HTH-type transcriptional regulator HI_0143 (HI_0143) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 71% identity to stm:STM1127)

Predicted SEED Role

"Sialic acid utilization regulator, RpiR family" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AV98 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BWI76_RS00065 MurR/RpiR family transcriptional regulator (Klebsiella michiganensis M5al)
MTTPTSPVKAGKILDTLGAMQSSMTRVGKSIAQFVMTSPHKVTQLSIADLSEEVNAGEAS
VIRFCRQLGYKGFQNFKMELAIELAMTDTDDNSTLLEAEIQKADDAHTIGLKLQGAISTV
LSETLNLLDMEQVERVVEALHSCNSTFIFGVGASGLTAEEMKHKLMRIGMRVDALTNNHF
MYMQAALLKAGDVAIGISHSGHSPETTHALSLAKQAGAVTVALTHNLGSPLSKVADITLI
NGNRQGRLQGDSIGTKTAQLFVLDLIYTLLVQKDPEAARANKLRTMDALSTLK