Protein Info for BWI76_RS00020 in Klebsiella michiganensis M5al

Annotation: chromosomal replication initiation protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 69.5 bits, see alignment E=4.8e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 464 (459 residues), 620.2 bits, see alignment E=1.2e-190 PF00308: Bac_DnaA" amino acids 132 to 291 (160 residues), 250.3 bits, see alignment E=3.1e-78 PF01695: IstB_IS21" amino acids 167 to 269 (103 residues), 34.1 bits, see alignment E=6.5e-12 PF00004: AAA" amino acids 168 to 269 (102 residues), 26.3 bits, see alignment E=2.6e-09 PF08299: Bac_DnaA_C" amino acids 375 to 443 (69 residues), 112.4 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 98% identical to DNAA_KLEP3: Chromosomal replication initiator protein DnaA (dnaA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 98% identity to kpu:KP1_5483)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVB5 at UniProt or InterPro

Protein Sequence (466 amino acids)

>BWI76_RS00020 chromosomal replication initiation protein DnaA (Klebsiella michiganensis M5al)
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNIN
GLLNDFCGADAPQLRFEVGAKPAVQMQRGTVSVAAAAPAQQIQTARVAPTIVRPGWDNVP
APAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHL
LHAVGNGIVARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFA
NKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELET
RVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVRE
ALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHS
LPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS