Protein Info for BPHYT_RS35775 in Burkholderia phytofirmans PsJN

Annotation: ribulose bisphosphate carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02788: RuBisCO_large_N
  • amino acids 24 to 138 (115 residues), 28.4 bits, E=1.6e-10
• PF00016: RuBisCO_large
  • amino acids 148 to 428 (281 residues), 259.5 bits, E=3.9e-81

Best Hits

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 100% identity to bpy:Bphyt_7230)

Predicted SEED Role

"similar to ribulose-1,5-bisphosphate carboxylase, Type III"

MetaCyc Pathways

• Rubisco shunt (9/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• oxygenic photosynthesis (11/17 steps found)
• nucleoside and nucleotide degradation (archaea) (1/10 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.39

Sequence Analysis Tools

See B2TAL3 at UniProt or InterPro

Protein Sequence (432 amino acids)

>BPHYT_RS35775 ribulose bisphosphate carboxylase (Burkholderia phytofirmans PsJN)
MSETLQQQAVDNDTLQADYLIETPLDPARVAEVMAGEQSSGTFVRVANESDALRARSRAG
VLRVEELEAAARPSLPNAWLERQGTPGPWRRARITLSFPLANIDANLPTLAATVAGNLYD
LGEVTGMRLLSLRLPASYRKRFELPRHGVAGTRALTEVKDRPMIGTIIKPNVGLSAAETA
ALVRDLCEAGVDFIKDDEVCANPAHAPLAERVRAVMAEVRRYRERSGRSVMVAFNITDDL
DAMRRHAELVEQEGGDCVMASINWCGFSAIQTLRRATPLVLHAHRNGYGMMSRDPALGMS
FQAYQTLWRLSGVDHMHVHGLAGKFAQSDAEVIESARDCATPLAAGCDDTVLPAFSSGQW
AGTVQATFDAVRSTDLLFMSGGGILAHPDGPAAGVTSVRQAWAAVQAGTPLPVYAEHMPE
LRRALAFFGSRA