Protein Info for BPHYT_RS35680 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 106.2 bits, see alignment E=5.7e-34 PF17912: OB_MalK" amino acids 235 to 289 (55 residues), 41.1 bits, see alignment 6.8e-14 PF08402: TOBE_2" amino acids 282 to 351 (70 residues), 39.4 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 55% identical to UGPC_BURTA: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_7210)

MetaCyc: 52% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system ATP-binding protein" in subsystem Chitin and N-acetylglucosamine utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAJ3 at UniProt or InterPro

Protein Sequence (360 amino acids)

>BPHYT_RS35680 sugar ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MAAVQLSGIFKRYGDTQVVHGIDLDIDDGEFVVLVGPSGCGKSTLMRMVAGLEEISGGDL
MIGGTRANSLAPQQRNISMVFQSYALYPHLSVYENIAFGPRIRKESSASFKPRIEAAAKM
LNLGGYLDRLPRALSGGQRQRVAMGRAVVREPSLFLFDEPLSNLDAKLRVQMRTEIKALH
QRLKNTVIYVTHDQIEAMTMADRIVVMNAGRIEQIGRPLELYDHPANLFVASFLGSPSMN
FAEGVIASRAQGQGLALNLTGGGEIVLEGAPASAVVGAKVTLGVRPEHIETMTPTPDATM
EVEVVEPTGAETHLYGKIGGSTWCVTTRQRSKIEPGQRVTLRLPAEHIHLFDTESGRRLV