Protein Info for BPHYT_RS35660 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 277 (187 residues), 71.2 bits, see alignment E=4.9e-24

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_7206)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAI9 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BPHYT_RS35660 membrane protein (Burkholderia phytofirmans PsJN)
MSLSVKMKRSLWCWLALSPLVVVVLFPFAVMLFTALKPASEIFVYPARWLPVHWQWSNFS
DMWVAANFGVALRNSTVISLLSTALALAVSLPAAYALARFPFRGRGLYRQFLLVTQMLSP
ILLVVGLFRLAAMIPYGDGNLVDSKIGVIVSYAAFNIAFAVWMLSSYFQTVPRDLEESAW
LEGCGRTKAVFKVFLPLAVPAIVVTAIFTFINAWNEFAVVYTLIRSPENKTLTVQVTDMV
AGKYVVQWHLVMAATLCATLPVSVVFAWLQRYLVKGLALGAVK