Protein Info for BPHYT_RS35500 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 55 to 75 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 362 to 386 (25 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 412 (391 residues), 146.2 bits, see alignment E=6.1e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7172)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAF6 at UniProt or InterPro

Protein Sequence (478 amino acids)

>BPHYT_RS35500 major facilitator transporter (Burkholderia phytofirmans PsJN)
MSASSSASAHAGASSLITSLVAAALFMENLDGSIIATALPQMAHSFHVTPVELSVGITSY
LLTLAVFIPISGWIADWAGVRTVFTAALAIFTVASVLCGLTDNLVEFTGARILQGIGGAM
MVPVGRLAVLRATPKEGLMRAVSIITWPGLVAPVLGPPLGGFITTYSSWRWIFYLNVPLG
LAGVVLAWRFISAERDTDRRPFDMLGFVLTGVAGTSVMYAMEAIGRVDSSWRIALVFLAI
GLAACAGAWFHLRRCTHPMVDLSAFRIKTFMVAIGGGSLFRIAIGSVPFLLPLMFQVGFG
MNPFQSGLLTLGVFAGNLSTKLVTTRILRRFGFRSVLLYNGAFAAVTLASMSLLTASTPY
GWILFALFVSGVARSLQFTAINTLGFADVPKQQMSGASTLSSTLGQMTMGMGVAAGAIAL
RIAAWWHGHDGQTLAPADFTIAFLVMAALSVIAVVDVISLSPDAGAHVSGHRPAGEKS