Protein Info for BPHYT_RS35390 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 318 (294 residues), 140.4 bits, see alignment E=7.3e-45 amino acids 315 to 422 (108 residues), 36.7 bits, see alignment E=2.5e-13 PF00083: Sugar_tr" amino acids 48 to 194 (147 residues), 59.5 bits, see alignment E=3e-20 amino acids 222 to 408 (187 residues), 31.5 bits, see alignment E=9.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7149)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAD4 at UniProt or InterPro

Protein Sequence (434 amino acids)

>BPHYT_RS35390 MFS transporter (Burkholderia phytofirmans PsJN)
MFTWYKRGTPLERSTFWGCFAGWGLDALDVQMFTLAIPAIIAAYGIDHTQAGAISGVTLV
SSAMGGWLAGALSDRIGRVRTLQITILWFAGFTFLCAFAQSFPQLLVLKALQGFGFGGEW
AAGAVLMAETISTEHRGKAMGAVQSAWAVGWGGAVLLYAAAFSWLPSDTAWRVMFGVGLL
PALLVLYVRRNLREPVRVAPSRAEPAVSVWAQIAQVFQPRVIKTTVIGAILGTGAHGGYY
AIMTWLPTFLSKERHLSVLNTGGYLAVVIVAFWCGCMASAYLLDRIGRRRNIAFFAFSCI
VTVLAYVMLPLSNTQMLVLGFPLGFFAAGIPASLGALFNELYPADMRGTGVGFCYNFGRI
ASAGFPVLVGYMSHSMSLGAAIGIDAAIAYGLAMVAVLLLPETRGKRLRPTAVEQASQPV
ADADFALDHPRSQR