Protein Info for BPHYT_RS35345 in Burkholderia phytofirmans PsJN

Annotation: decarboxylase UbiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 25 to 433 (409 residues), 287.5 bits, E=8.2e-90
• PF20695: UbiD_N
  • amino acids 25 to 93 (69 residues), 34.2 bits, E=3.5e-12
• PF01977: UbiD
  • amino acids 108 to 303 (196 residues), 193.8 bits, E=3.1e-61
• PF20696: UbiD_C
  • amino acids 310 to 431 (122 residues), 116.8 bits, E=9.7e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7140)

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• superpathway of chorismate metabolism (42/59 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

See B2TAC1 at UniProt or InterPro

Protein Sequence (464 amino acids)

>BPHYT_RS35345 decarboxylase UbiD (Burkholderia phytofirmans PsJN)
MADNLFRATQDFHRFALAYREHYPDDVLTLKQPLSADQDVTAVVAELAARGQHPMLICEK
VDGIATPLVTNFFASRTRIGRLFDVDASGLFDAYQHRANAPIAPVFVSNGPVLDQVIEGD
AVDLAQLPMIRHFDTDRGPYITNAVIVAEDPVTGVANLSYHRSMRHAKNALATSLHSRGH
LWRMLQTAQARGDTLKVAMVIGAHPLFMLAAAARVPFGTDERAIAGGLFGAPLQLVRTPR
YGIGVPACAEFVLEGTIDPSAHAEEGPFGEFTGYSSDRSTNNVLRVDTMMRRHDAWLVDV
VGGPYAEHLTLARLPREAEMSEKLKARFPSVTALHYPNSGTHFHCYVALNQTRDGEARQI
MLALLGWDPYLKNVVAVDSDIDITNDSQVLWAIATHFQPHQDVFIVDGLPGSPLDPSSSA
AGTTSRMGIDATRGSHFDGIRARISERASQEAVDILSRAAGVQQ