Protein Info for BPHYT_RS35315 in Burkholderia phytofirmans PsJN

Annotation: threonyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR00418: threonine--tRNA ligase" amino acids 1 to 389 (389 residues), 467.2 bits, see alignment E=5e-144 PF00587: tRNA-synt_2b" amino acids 81 to 289 (209 residues), 165.1 bits, see alignment E=1.8e-52 PF03129: HGTP_anticodon" amino acids 301 to 389 (89 residues), 65.3 bits, see alignment E=4.7e-22

Best Hits

KEGG orthology group: K01868, threonyl-tRNA synthetase [EC: 6.1.1.3] (inferred from 100% identity to bpy:Bphyt_7134)

Predicted SEED Role

"Threonyl-tRNA synthetase-related protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.3

Use Curated BLAST to search for 6.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAC3 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BPHYT_RS35315 threonyl-tRNA synthetase (Burkholderia phytofirmans PsJN)
DHRVIGNKLDLFHQQEEGVGMVFWHPRGWELYRVLEVYVRARMRRAGFREIRTPQLLARS
LWEKSGHWEKFGAAMYSLADAEEGRALCLKPMSCPCHVQVFNQRVRSYRELPVRYSEFGA
CHRDEPSGSLEGLKRTRAFVQDDAHVFCTEAQIEVEVGRFCALLRTVYADLGFPRFKVAL
ATRPAMRAGDDQTWDRAEDALANAARAAGLEFEVLEGEGAFYGPKLEFHLLDSRARSWQC
GTIQLDFVLPERLDAEFVNERNERERPVMIHHAVLGSMERFIAMLLEHHEGWLPVWLAPE
QVVVATISETNRAYAQEVMQALDDAGVRAVLDSRPERLEKKIVDAREKQVPLLVVVGSRD
ERDQTISIRLRDGRQMTVSFVEAVERLRSMALTPVMASKL