Protein Info for BPHYT_RS35225 in Burkholderia phytofirmans PsJN

Annotation: RNA polymerase subunit sigma-24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 11 to 175 (165 residues), 47.6 bits, see alignment E=7.1e-17 PF04542: Sigma70_r2" amino acids 20 to 78 (59 residues), 42.1 bits, see alignment E=9.5e-15 PF08281: Sigma70_r4_2" amino acids 124 to 174 (51 residues), 40.4 bits, see alignment 2.9e-14 PF20239: DUF6596" amino acids 192 to 293 (102 residues), 125.9 bits, see alignment E=1.1e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7116)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAA1 at UniProt or InterPro

Protein Sequence (424 amino acids)

>BPHYT_RS35225 RNA polymerase subunit sigma-24 (Burkholderia phytofirmans PsJN)
MTTAATHRAIEAVWRIESAKVIAHVARIVRDVGLAEELAQDALVSALEHWPDAGVPDNPG
AWLMATAKNRALDRLRQEALHARKHQELGHDLDAMEAHLVPDFVDALDAARADDIGDDLL
RLVFTACHPVLSTDARVALTLRLLGGLTTDEIARAFLVPEPTVAQRIVRAKRTLSAAKVP
FEVPQADARAPRLASVLQVIYLIFNEGYSATAGDDWMRPALCEEALRLGRVLSGLVPDES
EVHGLVALMEIQASRTHARTDAQGRPVLLLDQDRSRWDPLLIRRGLAALNSAHALGGASG
PYALQAALAACHARARRAEDTDWAQIVALYDALSQVAPSPVVELNRAVAVGMAFGPAAGL
EIVDALASDAALANYHWLPSVRGDLLAKLGRMEEARAEFERAAGMTRNARERELLLERAH
GIGH