Protein Info for BPHYT_RS35185 in Burkholderia phytofirmans PsJN

Annotation: DOPA 4,5-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08883: DOPA_dioxygen
  • amino acids 12 to 113 (102 residues), 117.2 bits, E=1.9e-38

Best Hits

KEGG orthology group: K10253, DOPA 4,5-dioxygenase [EC: 1.14.99.-] (inferred from 100% identity to bpy:Bphyt_7107)

Predicted SEED Role

"Aromatic ring-cleaving dioxygenase"

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Benzoate degradation via hydroxylation
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Naphthalene and anthracene degradation
• Nicotinate and nicotinamide metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.99.-

Use Curated BLAST to search for 1.14.99.-

Sequence Analysis Tools

See B2TA93 at UniProt or InterPro

Protein Sequence (116 amino acids)

>BPHYT_RS35185 DOPA 4,5-dioxygenase (Burkholderia phytofirmans PsJN)
MTFRDLSAITSWHAHVYFDAGSRDAAWTFREQISAHWGDALQLGRFHERLVGPHPMWSYQ
LAFTQSQFADVVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSYELVLSALN