Protein Info for BPHYT_RS35125 in Burkholderia phytofirmans PsJN

Annotation: glycogen-debranching protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 PF12439: GDE_N" amino acids 16 to 242 (227 residues), 199.7 bits, see alignment E=4.5e-63 TIGR01561: putative glycogen debranching enzyme, archaeal type" amino acids 16 to 589 (574 residues), 367.7 bits, see alignment E=6.3e-114 PF06202: GDE_C" amino acids 287 to 649 (363 residues), 369.6 bits, see alignment E=1.7e-114

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7095)

Predicted SEED Role

"glycogen debranching enzyme-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA81 at UniProt or InterPro

Protein Sequence (662 amino acids)

>BPHYT_RS35125 glycogen-debranching protein (Burkholderia phytofirmans PsJN)
MTHIERPFDMTRLEDEWLEADGFGGFASGTVGTLRTRRYHALLLTATRAPGGRVVLVNGV
EAWLEANNGARYPLSMQRYVPDVVYPDLTTSLVSFDTKPWPTWRVQIGASAVLTAEVFVS
KATRETVLRWRLEEGAGVDSETNALTLKVRPLLSGRDYHALHHENAAFNFNAQTSSDQAS
VDWQPYGDLPVIHAATNGVYTHAPDWYRNFCYLRERERGLDFSEDLATPGVFSLNLADGE
AVMILSASGATSVTQPATAKAAAIRATELARIEQQRRDALGSRLQRSADAYVVSRNEGRT
ILAGFPWFTDWGRDTFIAMRGLLIASGRLDDAEAILLEWSGTLSEGMLPNRFPDYGDTPE
YNSVDASLWFIVAVHDYLATRHASAATQQRLQQACEAILTGYTKGTRFNIQASADDGLLS
AGTRGVQLTWMDAKVGDWVVTPRIGKPVEVQALWINALRIAATWNPQWQPVAERALQAFH
ERFVDPSTQALFDNVDVDHVKGAIDRAIRPNQIFALGGLPFPLLDGAVARAVLDQVEAQL
LTPLGLRTLAPSDPAYRGHYGGSPLERDGAYHQGTVWPWLLGPFVEAWLRVNGGAADARM
QAKTRFLDPLYAHLDHAGLDHLSEIADGDAPHAPAGTPFQAWSLGELLRIEHLLAGLATA
GA