Protein Info for BPHYT_RS35060 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details amino acids 395 to 418 (24 residues), see Phobius details amino acids 433 to 456 (24 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 94 to 338 (245 residues), 74.7 bits, see alignment E=2e-24 PF00535: Glycos_transf_2" amino acids 97 to 276 (180 residues), 71.5 bits, see alignment E=1.7e-23 PF13506: Glyco_transf_21" amino acids 174 to 336 (163 residues), 28.1 bits, see alignment E=2.7e-10 PF13632: Glyco_trans_2_3" amino acids 190 to 386 (197 residues), 73.2 bits, see alignment E=5.6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7084)

Predicted SEED Role

"Glycosyltransferases, probably involved in cell wall biogenesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA70 at UniProt or InterPro

Protein Sequence (483 amino acids)

>BPHYT_RS35060 glycosyl transferase (Burkholderia phytofirmans PsJN)
MKKTLEQALALASPRVVPRRTTPLSTLIHLSVVVLWLLLFARAFFLQGALAWSTGIAYVV
YDTLLLAFVTWKTLPLMRRAPPLEPDFERRSLPSMGVIVASHNEATVLPVTIAALLRQTH
GPAQIVIADDGSTDATHELLTERFGLTAAADGVLSAPSALYPNLFWLRVPHGGKARALNA
AITVITTETVMTVDADTLLDDDATYAMRAAFASEPKLVAAAGILVPVCGKSLSGRVFQWF
QTYEYMRNFIARFAWMRADSLLLISGAFASFKRDALVDVGGFDPQCLVEDYELIHRLRRY
SVDHDLGWDVRVVGEAHARTDAPDNLASFLRQRRRWFAGFLQTQYWNRDMTGNPRYGMLG
MLMLPVKAIDTMQPIYGLTAFALLLAFVFGGHGAIVVSIFSVIGIKTAIDLAFYLWSIHL
YRRWTGERTGSGLWMAMLAAVAEPFTFQLVRHVGAALGWLHFLRGGRSWGVQRRSGLVAH
DES