Protein Info for BPHYT_RS35000 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1160 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF20148: DUF6531" amino acids 132 to 195 (64 residues), 33.1 bits, see alignment 5.7e-12 PF05593: RHS_repeat" amino acids 317 to 346 (30 residues), 29.2 bits, see alignment (E = 9.6e-11) amino acids 331 to 367 (37 residues), 39.8 bits, see alignment (E = 4.7e-14) amino acids 556 to 587 (32 residues), 24.2 bits, see alignment (E = 3.6e-09) amino acids 573 to 608 (36 residues), 27.9 bits, see alignment (E = 2.5e-10) amino acids 594 to 630 (37 residues), 25.8 bits, see alignment (E = 1.1e-09) amino acids 614 to 650 (37 residues), 27.8 bits, see alignment (E = 2.6e-10) amino acids 635 to 671 (37 residues), 28 bits, see alignment (E = 2.2e-10) amino acids 802 to 839 (38 residues), 23.2 bits, see alignment (E = 7.1e-09) TIGR01643: YD repeat (two copies)" amino acids 331 to 369 (39 residues), 35.1 bits, see alignment (E = 1.3e-12) amino acids 352 to 393 (42 residues), 18.7 bits, see alignment (E = 2e-07) amino acids 445 to 476 (32 residues), 20 bits, see alignment (E = 7.7e-08) amino acids 510 to 551 (42 residues), 20 bits, see alignment (E = 7.3e-08) amino acids 556 to 589 (34 residues), 18.7 bits, see alignment (E = 1.9e-07) amino acids 594 to 634 (41 residues), 25.4 bits, see alignment (E = 1.5e-09) amino acids 635 to 676 (42 residues), 31.5 bits, see alignment (E = 1.8e-11) TIGR03696: RHS repeat-associated core domain" amino acids 1018 to 1093 (76 residues), 78.1 bits, see alignment 5.6e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7071)

Predicted SEED Role

"Rhs family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA57 at UniProt or InterPro

Protein Sequence (1160 amino acids)

>BPHYT_RS35000 hypothetical protein (Burkholderia phytofirmans PsJN)
MQVTDGIAARRALLRPFILSFFMLLSWFVVPHAHAECFDDYVSNGAYPTDPNCGFLAASA
NFKSGFACGEPFTIASYCGGASGGTTVEPISPDDTVTLDGDGTGGQPGGSDGSGGCSGGD
ATAGCGSSTSGGDPVRLYTGQFHLVAHDLHVADTIALDLARVYRSSAYDTSGRPMAGAFG
IGATFNYDSYLTVSAADSNNLRQLIQLYLPSGIHVPFTLRAGTSATWDDLTSAGEFYRGS
ITGNGTTKLLTLRDGHTMQFTMFAGLYRLTRVQDRNGNTVAINRNSSTGAITGINCPNGR
ALTFASIVGARGTPLVSRISDPLNRQVNYQYDGQDRLTQVTDAGGGVWKYGWDTKSRLVS
VTDPEGNQQVVNTYDDSDRVTAQKLADGSTFGFAYTVTGSKITQTDVTDRRGSIRRVVFD
ANGRVVSNTYPAGQSIAQVQTFTRDPTGRVTNLTAADRRYTYTYDANGNRISEADQYGVL
ATRTFDSYSQVLTEAQAGDPQRGVSTVYTYDAKGNRLTLTDRLGNRTTQTNDSQGRPLTV
TDALKGVTKYTWSGADLTAITDALSRTTQFTADAAGRVTAVQDPLGNKTTRTLDALDRTT
TVIDALGGVTRFTWDHNGHLLGQADPKGVTTAYTYNAIGRAVSKSDPLGHAETYTWNNAG
QLASVTDRKGQLTTYWYDVAGELQSVYFNPDGNPLGAPVRSLGYGWDEYGRLQGTSDGGV
GRTPVGSRYYFDSVTGKVSQWVETPGTQQGFITYGYDPDSRDLSFIGAKDGTISYSHDAE
HRVTQVQYAVDGEPLRVFGYKYDALGRGSQATLANGITATYTWDAASQLTGITYKRADGS
VLGDLTYGYDLAGRRTSAGGSFAKADLPAAVSDAQYNAANQLTHWSGNTLAYDLNGNLAS
DGSNRYMWNEQNLLGQISGSVSASFSYDIWGRRRDQTVNGHSQQSFWNGDELRFTIVDGD
YAHRNRMFSAYPESRLDELTYRRIGDDAGQDSYILRDANNNVIALTDANQQSQTQYTYQP
YGTTTQTGAVDPNLQQYTGRENDGTGLYYYRSRYYSPAIGRFISEDPIGYASGQTNGYAY
VGGNPVQFTDPAGEVGLPMNGPANTWVLNPSGSGQTRLYDPNGRPAVDLDFDHSHGGMRP
HAHNWDGNNRDWAVAPFCPL