Protein Info for BPHYT_RS34930 in Burkholderia phytofirmans PsJN

Annotation: Rieske (2Fe-2S) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF13806: Rieske_2" amino acids 4 to 102 (99 residues), 50.8 bits, see alignment E=1.4e-17 PF00355: Rieske" amino acids 4 to 90 (87 residues), 67.6 bits, see alignment E=7.3e-23

Best Hits

Swiss-Prot: 36% identical to NAGAB_RALSP: Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component (nagAb) from Ralstonia sp.

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 95% identity to bug:BC1001_4736)

MetaCyc: 36% identical to 6-hydroxypicolinate 3-monooxygenase subunit 1 (Alcaligenes faecalis)
1.14.13.-

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA43 at UniProt or InterPro

Protein Sequence (104 amino acids)

>BPHYT_RS34930 Rieske (2Fe-2S) protein (Burkholderia phytofirmans PsJN)
MTEQWRCAGHAGDLSDDAPLEFKLDGTEIGIYKVGDALYALENVCPHAYALLTQGFVDGD
TVECPLHEAVFHIPTGKCLKEPGGRDLKVYSVRLAGEEIQIKVE