Protein Info for BPHYT_RS34860 in Burkholderia phytofirmans PsJN

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 10 to 32 (23 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 183 to 208 (26 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 262 (255 residues), 194 bits, see alignment E=1.6e-61

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to bpy:Bphyt_7043)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA29 at UniProt or InterPro

Protein Sequence (298 amino acids)

>BPHYT_RS34860 chemotaxis protein (Burkholderia phytofirmans PsJN)
MNQYDLRRGIALSVCATTTFALLSAYATLLAPLSGLDIFAWRVIWTVPGALLLVALRKRL
PILRRLLYRMVTEPKLGMAMIVSAALLGVQLWVFLWAPLHGRMLEVSLGYFLMPLTMVLV
GRFYYHERLDGLQWLAVACAATGVGHELWVTGAFSWPTLLVSLGYPPYFVLRRKINHDSL
AMFTVEMALLLPPAIALVFNGGSLAMIAGHPGRWWLLLPGLGALSTIALASYLKASRLLP
VALFGILGYVEPVLLVLISITVLGETLSVSQLATYVPIWIAVALTALHSVRLVRLAPS