Protein Info for BPHYT_RS34845 in Burkholderia phytofirmans PsJN

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02719: Polysacc_synt_2" amino acids 9 to 119 (111 residues), 34.6 bits, see alignment E=4.2e-12 TIGR03466: hopanoid-associated sugar epimerase" amino acids 9 to 334 (326 residues), 526.5 bits, see alignment E=1e-162 PF05368: NmrA" amino acids 9 to 122 (114 residues), 50.8 bits, see alignment E=5.5e-17 PF01370: Epimerase" amino acids 9 to 236 (228 residues), 119 bits, see alignment E=8e-38 PF01073: 3Beta_HSD" amino acids 10 to 224 (215 residues), 73.2 bits, see alignment E=6.5e-24 PF16363: GDP_Man_Dehyd" amino acids 10 to 255 (246 residues), 50.6 bits, see alignment E=7.5e-17 PF13460: NAD_binding_10" amino acids 13 to 176 (164 residues), 60.8 bits, see alignment E=5.8e-20 PF07993: NAD_binding_4" amino acids 61 to 184 (124 residues), 40 bits, see alignment E=9.5e-14

Best Hits

KEGG orthology group: K00091, dihydroflavonol-4-reductase [EC: 1.1.1.219] (inferred from 100% identity to bpy:Bphyt_7040)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.219

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T812 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BPHYT_RS34845 NAD-dependent dehydratase (Burkholderia phytofirmans PsJN)
MTEQNRDLVLVTGASGFVGSSVARIAQQKGFRVRVLVRATSPRQNVESLDAEIVVGDMRD
EASMRNALRGVRYLLHVAADYRLWAPDPSEIERSNLEGTEATMRAALKEGVERMVYTSSV
ATLKVTSSGQSADETSPLKADQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVATGHFLALERGKIGERYILGGENL
PLQQMLADIAALTGRKAPTLSLPRWPLYPLAMGAEAVAKITKREPFVTVDGLKMSKNKMY
FSSAKAERELGYRSRPYREGLSDALDWFRQAGYLKP