Protein Info for BPHYT_RS34820 in Burkholderia phytofirmans PsJN

Annotation: radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR03470: hopanoid biosynthesis associated radical SAM protein HpnH" amino acids 1 to 319 (319 residues), 565.3 bits, see alignment E=1.7e-174 PF04055: Radical_SAM" amino acids 35 to 184 (150 residues), 58.6 bits, see alignment E=9.3e-20 PF11946: DUF3463" amino acids 195 to 329 (135 residues), 206.5 bits, see alignment E=1.3e-65

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7035)

MetaCyc: 64% identical to adenosyl hopane synthase (Rhodopseudomonas palustris TIE-1)
RXN-13528

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T807 at UniProt or InterPro

Protein Sequence (384 amino acids)

>BPHYT_RS34820 radical SAM protein (Burkholderia phytofirmans PsJN)
MSIPLLQKVRVGAYIMRQHLSGNKRYPLALMLEPLFRCNLACNGCGKIDYPDPILNQRLS
LQECLEAVDECNAPVVSIAGGEPLLHKEMPQIVKGIMARKKFVYLCTNALLMEKKMDDYE
PNPYFVWSVHLDGDQQAHDHSVSQEGVYDKAVAAIKEAKRRGFRVNINCTLFNDAVPERV
AAFFDTLGPMGVDGITVSPGYAYERAPDQQHFLNRDKTKHLFREIFKRGNNGKNWSFSQS
SMFLDFLAGNQTYECTPWGNPARTVFGWQKPCYLVGEGYVKTFKELMETTQWEKYGTGNY
EKCADCMVHCGFEATAVMDTVTHPLKALKVSLRGPKTSGAFTKDIPLDKQRPAEYVFSRH
VEIKLEEIKVSGKGKKVQTATAAT