Protein Info for BPHYT_RS34790 in Burkholderia phytofirmans PsJN

Annotation: squalene--hopene cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 transmembrane" amino acids 156 to 174 (19 residues), see Phobius details amino acids 194 to 210 (17 residues), see Phobius details TIGR01507: squalene-hopene cyclase" amino acids 34 to 665 (632 residues), 782.1 bits, see alignment E=4.1e-239 TIGR01787: squalene/oxidosqualene cyclases" amino acids 41 to 662 (622 residues), 620.6 bits, see alignment E=3.4e-190 PF13249: SQHop_cyclase_N" amino acids 42 to 332 (291 residues), 408.1 bits, see alignment E=5.1e-126 PF00432: Prenyltrans" amino acids 89 to 130 (42 residues), 31.4 bits, see alignment 3.2e-11 amino acids 436 to 454 (19 residues), 11.6 bits, see alignment (E = 5e-05) amino acids 509 to 544 (36 residues), 24.6 bits, see alignment 4.4e-09 amino acids 551 to 604 (54 residues), 31.3 bits, see alignment 3.5e-11 PF13243: SQHop_cyclase_C" amino acids 341 to 662 (322 residues), 487.8 bits, see alignment E=3.4e-150

Best Hits

Swiss-Prot: 64% identical to SQHC_SINFN: Probable squalene--hopene cyclase (shc) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K06045, squalene-hopene cyclase [EC: 5.4.99.17] (inferred from 100% identity to bpy:Bphyt_7029)

Predicted SEED Role

"Squalene--hopene cyclase (EC 5.4.99.17)" in subsystem Carotenoids (EC 5.4.99.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T801 at UniProt or InterPro

Protein Sequence (676 amino acids)

>BPHYT_RS34790 squalene--hopene cyclase (Burkholderia phytofirmans PsJN)
MNDLSQAQPLDAILPDFADAAPSAPAPAVTGEAPTASLDAAITRATEAILAAQKPDGHWV
YELEADATIPAEYVLLVHYLGETPNLELEQKIARYLRRIQLPDGGWPLFTDGALDISASV
KAYFALKMIGDPADAEHMVRAREAILAHGGAETVNVFTRILLALFGVVSWRAVPMMPVEI
MLLPMWFPFHLSKVSYWARTVIVPLLVLNAKRPVARNPRRVRIDELFRGAPVNTGPRDRA
PHQHAGWFRFFSGVDVLLRAVDGLFPKSTRERAVRQAVAFVDERLNGEDGLGAIFPAMAN
SVMMYDVLGYPADHPNRAIARQSIDKLLVIKDDEAYCQPCLSPVWDTSLAAHALLETGEA
HAEQAAERGLAWLRPLQILDVRGDWISRRPNVRPGGWAFQYNNAHYPDVDDTAVVAMAMQ
RSATVTQSDVDRDAIARAREWVVGMQSSDGGWGAFEPENTQYYLNNIPFSDHGALLDPPT
ADVSGRCLSMLAQLGELPQNSEPAQRAFDYMLKEQESDGSWYGRWGLNYIYGTWTALCSL
NAAGLPHDDPRMKRAAQWLLSIQNEDGGWGEGGESYKLDYHGYERAPSTASQTAWALMGL
MAAGEVNHEAVARGVAYLEREQREHGLWDETRFTATGFPRVFYLRYHGYRKFFPLWALAR
FRHLKRNGLTRVAVGM