Protein Info for BPHYT_RS34785 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR03467: squalene-associated FAD-dependent desaturase" amino acids 5 to 415 (411 residues), 358.6 bits, see alignment E=3.2e-111 PF01134: GIDA" amino acids 5 to 33 (29 residues), 23.5 bits, see alignment (E = 5.5e-09) PF00890: FAD_binding_2" amino acids 7 to 39 (33 residues), 21.3 bits, see alignment (E = 2.8e-08) PF13450: NAD_binding_8" amino acids 7 to 65 (59 residues), 46.6 bits, see alignment E=6.9e-16 PF01593: Amino_oxidase" amino acids 12 to 415 (404 residues), 139.4 bits, see alignment E=4.3e-44

Best Hits

Swiss-Prot: 53% identical to HPNE_RHOPA: Hydroxysqualene dehydroxylase (hpnE) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7028)

MetaCyc: 53% identical to hydroxysqualene dehydroxylase (Rhodopseudomonas palustris CGA009)
RXN-17128 [EC: 1.17.8.1]

Predicted SEED Role

"Phytoene desaturase (EC 1.14.99.-)" in subsystem Carotenoids (EC 1.14.99.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.99.-

Use Curated BLAST to search for 1.14.99.- or 1.17.8.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T800 at UniProt or InterPro

Protein Sequence (422 amino acids)

>BPHYT_RS34785 hypothetical protein (Burkholderia phytofirmans PsJN)
MQKLVHVVGAGLAGLAAAVQLQRRGAHVVLHEAAAQAGGRCRSYYDPKLGATLDTGNHML
VSGNTATLNYVRAIGAADELVGPAQPEYPFVDLATRARWTVRMSPGHLPWWVFDPNARVP
NTGPADYLALAPLLLARPGRSVAQTMRCNGPLWDRLLRPLFHAMLNVEPRDASAELTGAM
VREALLAGGLACRPLVARNGLGSAFVDPALRLLQHGGAAIRLGSRLDGIVFAADNRRVQA
LHFAGESVTLDANHAVILAVPPDIAQTLVQGLRAPTRFAATVNVHFAVEPPFGLPQVTGL
LNGTAEWLFAFEGRLSVTVNGAERLLDTPHEALAASVWAEVAQAASLPAAPMPAWQVVVE
KRATFAALPDQETRRPGTRTRWNNLMLAGDWTATGLPATIEGAIRSGQKAADTLLNEPME
RR