Protein Info for BPHYT_RS34705 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 43 to 321 (279 residues), 221.1 bits, see alignment E=9.4e-70 PF13379: NMT1_2" amino acids 50 to 210 (161 residues), 29.7 bits, see alignment E=1.2e-10 PF12974: Phosphonate-bd" amino acids 66 to 212 (147 residues), 38.6 bits, see alignment E=1.7e-13 PF04069: OpuAC" amino acids 66 to 239 (174 residues), 26.9 bits, see alignment E=7.4e-10 PF09084: NMT1" amino acids 83 to 238 (156 residues), 47.5 bits, see alignment E=4.3e-16

Best Hits

Swiss-Prot: 48% identical to SSUA_ECOLI: Putative aliphatic sulfonates-binding protein (ssuA) from Escherichia coli (strain K12)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_7013)

MetaCyc: 48% identical to aliphatic sulfonate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7Y5 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BPHYT_RS34705 ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MSRHPLLARRAFIAGVGATLAAATLPVISTSAFAAEAHAKEFRIGYQKAANTLVLLKAHG
TLEKRLAPLGVTVKWTEFAAGPQLLEGLNVGAIDFGYVGEAPPVFAQAAGANFVYVAYEV
PTPHAEGILVHRDAPIKTLADLKGKKIALNKGSDVHWFLVAALQKAGVKYSEIQPVYLAP
ADARAAFERGAIDAWAIWDPFLEAAKRQSNARLLTDADGIVSHHQFFLSARSFAEQNANV
LDITMDEVGKEGAWVRGHYSEAAAQLAPIQGLDAGVIEAGLRHYAHVYKPVDANVLAEQQ
RIADAFSELRIIPTKIVTKDAALPGRKV