Protein Info for BPHYT_RS34610 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details PF00672: HAMP" amino acids 159 to 208 (50 residues), 29.1 bits, see alignment 1.5e-10 PF00512: HisKA" amino acids 216 to 269 (54 residues), 29.9 bits, see alignment 7e-11 PF02518: HATPase_c" amino acids 312 to 414 (103 residues), 63.9 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6994)

Predicted SEED Role

"Osmolarity sensor protein envZ (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7W6 at UniProt or InterPro

Protein Sequence (415 amino acids)

>BPHYT_RS34610 histidine kinase (Burkholderia phytofirmans PsJN)
MTNPFNTLFGRLSLMTVSLIVLVHITALLLVDRERGQIDTGHARQALLLAVQAEHDGALA
ASHVSAILGVSYVKAGDVIAAGCPAPCENTSGPFERDLRAKLPTGSQVVADADDGTVWVH
YAGYPDWLKLRNSMLPARRFLGASATMLVLAVIIALVGAWHLQRPLHRLALAAREFRIDH
RAPVVEASGPRELKELIGDFNQMVHELAQAGQERAVMLAGVAHDLRAPITRMQVRADLLP
DEANRRGFLRDAESLSRIVTQFLDFARETADSSPRTNVDAHCRRHYGDSLADDALVRLNL
HAGDGFELPLVDLDRILTNLIENALTYGEPAVEISTSRHNGRFTLEVRDHGGGIPGGQLD
RALQPFVRLDEARSGDAHCGLGLAIVRRLVRYNSGAFHADNAADGGFVVSMTFPA