Protein Info for BPHYT_RS34395 in Burkholderia phytofirmans PsJN

Annotation: multidrug transporter MatE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details PF01810: LysE" amino acids 16 to 196 (181 residues), 53.5 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6949)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9Y8 at UniProt or InterPro

Protein Sequence (199 amino acids)

>BPHYT_RS34395 multidrug transporter MatE (Burkholderia phytofirmans PsJN)
MLSASAIALLAVGIIVVLITPGPTNTLLAAAGLRQGVRRSLPLIAAELGGYLVSISVWGH
FLVQAAHALPWLPSLLRVAAGLYIAYLAVDMWRAAVALPDSAQRASGMRTLFVATLLNPK
GLLFAGTIFPAIAFAHLPAYVFSMLIFACLLVPIALAWIAFGAALGSGKLGWLNPVKMQR
GASIVLGVFSLSLAWAALH