Protein Info for BPHYT_RS34245 in Burkholderia phytofirmans PsJN

Updated annotation (from data): ABC transporter for L-rhamnose/L-fucose/xylitol, ATPase component
Rationale: Specifically important for utilizing L-rhamnose, L-fucose, and xylitol.
Original annotation: multidrug ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF00005: ABC_tran" amino acids 30 to 179 (150 residues), 101.2 bits, see alignment E=1.2e-32 amino acids 283 to 437 (155 residues), 71.1 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to bpy:Bphyt_6919)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9V9 at UniProt or InterPro

Protein Sequence (510 amino acids)

>BPHYT_RS34245 ABC transporter for L-rhamnose/L-fucose/xylitol, ATPase component (Burkholderia phytofirmans PsJN)
MNGQMSELTSSVPVVEALEVTKRFGSTAALNDVSIRVMPGESHALVGRNGAGKSTLVSIL
TGLRKPDTGEVRFSGAAAPSIADRDAWRERVACVYQHSTIIRDLSVAENLFINRQPLRGG
VIDWQAMRRDARALLDHWKIDVREDARAGDLSVEARQLVEIARALSYGARFIILDEPTAQ
LDGDEIKRLFRRISELQREGVTFLFISHHLQEVYEICQAVTVLRDARHIVSAPVSALPRE
QLIEAMTGERGGLAVADAAARGALPADTAVALELKELTGADYEGVSFTVKRGEVVGLTGA
TSSGRTSVAEAIAGLRAAKRGTISVDGAILPPGDVPASLAHGIGCVPKDRHHEGLVLTQS
VAENASMTIARVLGKFGIAAPAKKNAFGQKMIDALGIVAQGPEHVVSGLSGGNQQKVVMA
RALATNPNVLVLIDPTAGVDVKSKEALLSVVDRVREEGKAVLVVSGELDDLRTCDRVLVM
FRGRVAAEFPAGWQDHDLIASVEGVSLHEE