Protein Info for BPHYT_RS34240 in Burkholderia phytofirmans PsJN

Updated annotation (from data): ABC transporter for L-rhamnose/L-fucose/xylitol, permease component
Rationale: Specifically important for utilizing L-rhamnose, L-fucose, and xylitol.
Original annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 186 to 215 (30 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 67 to 338 (272 residues), 121.2 bits, see alignment E=2.3e-39

Best Hits

Swiss-Prot: 32% identical to LSRC_KLEP7: Autoinducer 2 import system permease protein LsrC (lsrC) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_6918)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9V8 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BPHYT_RS34240 ABC transporter for L-rhamnose/L-fucose/xylitol, permease component (Burkholderia phytofirmans PsJN)
MKNSVPSPAFGAAQAGAQSQLALPASRGKRARSELARLRELALLPALALLIVIGAFISPS
FLTKANLISVLGASAALALVVLAESLIVLTGKFDLSLESTVGIAPAVGAMLVMPAASAGF
GMQWPAAAGLLAIVVVGAVIGFINGFLVVRLRLNAFIVTLAMLIVLRGMLVGATKGGTLF
DMPTSFFALATTIVLGLPLSVWLAAAAFAIAAFMLRYHRLGRALYAIGGNPEAARAAGIR
VERITWGVFVLGSILASVGGLIVTGYVGAINANQGNGMIFTVFAAAVIGGISLDGGKGTM
FGALTGVLLLGVVQNLLTLAQVPSFWIQAIYGAIILGSLMVARLASGEGQN