Protein Info for BPHYT_RS34050 in Burkholderia phytofirmans PsJN

Annotation: secretion system protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 81 to 130 (50 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details PF00482: T2SSF" amino acids 154 to 279 (126 residues), 57.9 bits, see alignment E=5.4e-20

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 100% identity to bpy:Bphyt_6878)

Predicted SEED Role

"Type II/IV secretion system protein TadC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9R8 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BPHYT_RS34050 secretion system protein F (Burkholderia phytofirmans PsJN)
MLLLIAFVVSFGLIAVIAIGYKSVNGLAGSVPDENRTFLDPLPKSLRVLWPLVNFVVHHF
GGKFSRKLVEKTDLQLRLTSLTFLMNAHQFIALSIIASVLATLVALLLMLALGMFSALVL
LGVAVLGYFYPRIWTRDVRRRRVARILKHLPIYLDFLTLAVEAGLNINGAIQKAVEKGPE
GPLRWEFEHVLRDLKSGLNRMEALYRMDDRLRIKEVTNLVGTVVQAERMGSGLSKSLRFQ
SEQRRSERFQRAEKQAMEAPVKLVFPLLVFIFPITFIVLGFPIAMKFVQEGLL