Protein Info for BPHYT_RS33690 in Burkholderia phytofirmans PsJN

Annotation: molybdate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 160 to 161 (2 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 9 to 211 (203 residues), 241 bits, see alignment E=4.8e-76 PF00528: BPD_transp_1" amino acids 23 to 214 (192 residues), 67.7 bits, see alignment E=5.9e-23

Best Hits

Swiss-Prot: 47% identical to MODB_ECOLI: Molybdenum transport system permease protein ModB (modB) from Escherichia coli (strain K12)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to bpy:Bphyt_6805)

MetaCyc: 47% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9J7 at UniProt or InterPro

Protein Sequence (224 amino acids)

>BPHYT_RS33690 molybdate ABC transporter permease (Burkholderia phytofirmans PsJN)
MQQAWIPLLLSLKVAGWATALNLVFGVAAAFGLSRWRSGARDVIDSLLMLPLVMPPTVLG
YYLLVLLGRRGVIGGWLDRFDIQLVFTWQGAVIASTVVAFPLVLKSARAAFEAVDPQLER
AARTLGVSETAVFFRVTLPLAARGILAGGLLAFARALGEFGATLMIAGNLPGRTQTLSVA
VYSAVQAGDDSTANFLVLVTSVTCVVILLLAGRLVPQHTLLKSG