Protein Info for BPHYT_RS33685 in Burkholderia phytofirmans PsJN

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF12849: PBP_like_2" amino acids 25 to 242 (218 residues), 30 bits, see alignment E=1.1e-10 PF13531: SBP_bac_11" amino acids 31 to 254 (224 residues), 194.8 bits, see alignment E=4.7e-61 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 36 to 252 (217 residues), 198.9 bits, see alignment E=5e-63 PF01547: SBP_bac_1" amino acids 36 to 246 (211 residues), 79.4 bits, see alignment E=1.2e-25 PF12974: Phosphonate-bd" amino acids 89 to 254 (166 residues), 35.5 bits, see alignment E=2e-12 PF13343: SBP_bac_6" amino acids 153 to 256 (104 residues), 36.4 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_6804)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9J6 at UniProt or InterPro

Protein Sequence (257 amino acids)

>BPHYT_RS33685 molybdate ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MTLSRRLLKQALFVASAVSVAISANARADELVVSAAASLTNAFKAVSEAFEHQHPGTKVL
LNFGASDVLMQQIVKGAPADVFASADQKAMDKAAAEKVIVPATRKDFAANSLVLIVPTDS
RFAPTALNDLTSANVKRVAYGDPASVPVGRYTQGALQAAGVWDAVSAKAVLAANVRQSLD
YVSRGEVDAGFVFSTDAAVMPDKVKIALNVPTQTPITYPIAQVEGSRHAADAQAFMNFVL
SPAGQAVLAKYGFKPAH