Protein Info for BPHYT_RS33680 in Burkholderia phytofirmans PsJN

Annotation: phosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details PF01569: PAP2" amino acids 74 to 152 (79 residues), 38.6 bits, see alignment E=4.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6803)

Predicted SEED Role

"Membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9J5 at UniProt or InterPro

Protein Sequence (233 amino acids)

>BPHYT_RS33680 phosphoesterase (Burkholderia phytofirmans PsJN)
MPDLPAHLWYSITSLGGAGMTLPLAFAIALWLAVGYTWRMAAAWLLLLGAAIGIVTVTKL
AFLGWGVGVRGLDFTGVSGHAMLSTAVYPVVLFLMLLPARPSIRLAGVLLGLAAGIAVGL
SRVVLSAHSPSEAITGCLTGALAALVFVRLAWHAEPGRLSALPVAISMMVLAVLAHGVHV
PTQRWVTHIALKVSGHDRPFIRAKWKAVRDAHPALAPLSQTLNMLAPPHSSDV