Protein Info for BPHYT_RS33590 in Burkholderia phytofirmans PsJN

Annotation: Rieske (2Fe-2S) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF00355: Rieske" amino acids 54 to 122 (69 residues), 47.2 bits, see alignment E=1.7e-16 PF00848: Ring_hydroxyl_A" amino acids 172 to 364 (193 residues), 136.6 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: K00499, choline monooxygenase [EC: 1.14.15.7] (inferred from 100% identity to bpy:Bphyt_6784)

MetaCyc: 61% identical to putrescine 2-hydroxylase (Bordetella bronchiseptica)
1.14.13.M64 [EC: 1.14.13.M64]

Predicted SEED Role

"GbcA Glycine betaine demethylase subunit A" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.M64 or 1.14.15.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9H6 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BPHYT_RS33590 Rieske (2Fe-2S) protein (Burkholderia phytofirmans PsJN)
MSNLSNALQLRSVHSQLPVTAYFDEALLTREIETLFKKGPRYIGHDLMVPEAGNYFALPS
ESEGRVLVRNQQSQVELLSNVCRHRQAIMLNGRGQTENIVCPLHRWTYDLNGQLLGAPHF
ADNPCLNLGATSLQNWQGLLFEAQGRDVARDLARLGTKQHFDFSGFMFDHVEVHECNYNW
KTFIEVYLEDYHVAPFHPGLGSFVNCDDLTWEFGEWYSVQTVGVHKDLEQPGSPTYRKWH
DEVLRFRGGNPPEFGAIWMVYYPGIMIEWYPHVLVVSWLIPRGPQKTTNVVEFYYPEEIA
LFEREFVEAERAAYMETAREDDEIAERMDAGRRVLMNRGESQVGPYQSPMEDGMQHFHEF
LRRELGTI