Protein Info for BPHYT_RS33480 in Burkholderia phytofirmans PsJN

Annotation: cold-shock protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 PF00313: CSD" amino acids 3 to 65 (63 residues), 102.7 bits, see alignment E=3.9e-34

Best Hits

Swiss-Prot: 72% identical to CSPG_SHEVD: Cold shock-like protein CspG (cspG) from Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)

KEGG orthology group: None (inferred from 91% identity to bam:Bamb_5798)

Predicted SEED Role

"Cold shock protein CspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9F7 at UniProt or InterPro

Protein Sequence (67 amino acids)

>BPHYT_RS33480 cold-shock protein (Burkholderia phytofirmans PsJN)
MDTGTVKWFNDSKGFGFITPDKGGDDLFAHFSEISGDGFKTLAENQKVSFETKQGPKGLQ
AANIKPL