Protein Info for BPHYT_RS33475 in Burkholderia phytofirmans PsJN

Annotation: threonine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details PF01810: LysE" amino acids 16 to 204 (189 residues), 106.9 bits, see alignment E=4.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6764)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9F6 at UniProt or InterPro

Protein Sequence (211 amino acids)

>BPHYT_RS33475 threonine transporter (Burkholderia phytofirmans PsJN)
MTASTAIITILAALLLGAMSPGPSFVIVARNAIGLSRGDGLATALGMGVGGVFFSGIALL
GLYTLLASVEWLYVGLKVAGGLYLIYLASKIWRGAAKPLAFDASQAVSGNARKSFWIGLS
TQLSNPKTAVYYGSIFAALLPQHPPLWCYFALPPAIFAIEAGWYTVVALCFSSKRPREIY
LQWKAWVDRVAAIAVAALGLRLILTAHKVGI