Protein Info for BPHYT_RS33385 in Burkholderia phytofirmans PsJN

Annotation: major facilitator superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 305 (270 residues), 127.4 bits, see alignment E=9.3e-41 amino acids 243 to 417 (175 residues), 78.1 bits, see alignment E=9.6e-26 PF12832: MFS_1_like" amino acids 45 to 132 (88 residues), 27.7 bits, see alignment E=2.2e-10 amino acids 184 to 398 (215 residues), 29.7 bits, see alignment E=5.5e-11 PF00083: Sugar_tr" amino acids 68 to 161 (94 residues), 33 bits, see alignment E=4.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6746)

Predicted SEED Role

"Multidrug-efflux transporter, major facilitator superfamily (MFS) (TC 2.A.1)" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9D8 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BPHYT_RS33385 major facilitator superfamily protein (Burkholderia phytofirmans PsJN)
MNTPSQVSVPSGQPMHGLDYSARHERYWRRNLAVCVFGSFTTLVSLSMLLPFLPIYVQQL
GVQSQSAVIQWSGIAFGATFLGTAVTAPVWGRLADRYGRKPMLVRAAVGMAVVMSLIGVA
HNVHQLVALRLLAGLVGGYSSASTVMVGTQAPKERAGWALGVLSTGALAGNLIGPLVGGF
LPGWLGIRGTFFAGGAMIAVAALLTIFVVKEDFDPATHSSRRPPEHATASTHRNNYPVIA
ALLVTAMMVLLANMSIEPVITVYVGSLGVQSLHLARVAGIVMACSAFGSMLTAARLGALA
DRVGSWNVIVACLVLTGLVMIPQAFVHAWWQLAGLRALMGMTLAGLLPAIAKLARHAVEE
HKTGQMLGYLQSAQFSGQVVGPIIGGVIAVHLGLHSVFFVTGSLLVACAALAQWARTRQS
LAV