Protein Info for BPHYT_RS33380 in Burkholderia phytofirmans PsJN

Annotation: 2-nitropropane dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03060: NMO
  • amino acids 9 to 348 (340 residues), 279 bits, E=1.3e-86
• PF01070: FMN_dh
  • amino acids 142 to 245 (104 residues), 26.6 bits, E=6e-10
• PF05690: ThiG
  • amino acids 158 to 248 (91 residues), 24.2 bits, E=3.9e-09

Best Hits

Swiss-Prot: 64% identical to NMO_PSEAE: Nitronate monooxygenase (nmoA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6745)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Sequence Analysis Tools

See B2T9D7 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BPHYT_RS33380 2-nitropropane dioxygenase (Burkholderia phytofirmans PsJN)
MTSNTRFLQAIGAQHPIIQAPMAGISTPALAAAVSNAGALGSIAVGASTAQQARELIVAT
RALTSKPFNVNVFCHRPAYSDPLREATWLAHLQPLFAEFGARTPVALKEIYTSFVVDEAL
LQVLIEERPAVVSFHFGLPSREWINELHRAGILLFGCATTPHEARQIEQAGLDAIVAQGA
EAGGHRGVFNPDDDAMIGTLALVRMIARQSTLPVIAAGGIMDGQSVAGALLLGASAVQMG
TAFVLCPESGADAAYRTALTTQRAYRTAVTAAISGRPARGLSNRLYIDVDSPDAPPLPDY
PIAYDAAKALNAAARAKGNTEFAVQWAGQGAPLARALPAAQLVATLMSEL