Protein Info for BPHYT_RS33375 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details PF06779: MFS_4" amino acids 28 to 393 (366 residues), 275.1 bits, see alignment E=1.1e-85 PF07690: MFS_1" amino acids 28 to 351 (324 residues), 67.1 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6744)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9D6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>BPHYT_RS33375 membrane protein (Burkholderia phytofirmans PsJN)
MQRAVVNGPIPPAFNVWRGALAGASASLVGIGLARFAYTPLLPAIVSAHWFPASTAAYLG
AANLGGYLAGALAGGWLARRFDATSVLRAMMLLATVAFVACAFPVSFLWFFVWRFASGLA
GGALMVLAAPTVLAHVSPSRRGFASGAIFSGIGLGIVASGTIVPILLRQGLMETWLGLAA
ISLALTAVAWNGWPGRGESAAQHTTHHTRHGQTYPAASLRALYTEYALNAVGLVPHMIFL
VDFVARGLGKGLDAGAQYWVLFGLGAIVGPLLTGHLADRAGFGPALRAAFVLQIAAVALL
AVVRGPAALIVSSVVVGAFVPGIVALVLGRINELLAHHPAAQKGAWSAATTSFAVLQAVA
AYGLSFLFAHDGGNYTALFVIGAASLALALAVDLFAALRLGPKQA