Protein Info for BPHYT_RS33305 in Burkholderia phytofirmans PsJN

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 PF02129: Peptidase_S15" amino acids 373 to 514 (142 residues), 41.1 bits, see alignment E=3.7e-14 PF20434: BD-FAE" amino acids 389 to 586 (198 residues), 47.9 bits, see alignment E=2.4e-16 PF00326: Peptidase_S9" amino acids 413 to 628 (216 residues), 147.8 bits, see alignment E=6.6e-47 PF01738: DLH" amino acids 414 to 615 (202 residues), 27 bits, see alignment E=6.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6730)

Predicted SEED Role

"putative peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9C3 at UniProt or InterPro

Protein Sequence (632 amino acids)

>BPHYT_RS33305 peptidase (Burkholderia phytofirmans PsJN)
MSAVNDKEAADRTVKLYSVRDFFRRPEKHQFTISPDGRHLSFLTRHAGRQNIFVQEVGPD
GSPLGDARALTNETERDVPGHAWKGNDRILFVKDFGGDENYHVLSVPIHGGEPVDLTPFE
GVKASIVDDLRDDDRHILIQMNRRDPQVFDVFRVDVVTGAFTPIAENPGNIMGWMTDHAG
SLRVATASDGVNTTLLYRDTETEPFHPILTTNFRETVSPLFFTFDDRRLYVLSNRGRDKT
AIFEFDPQTAQEGELLFETEHVDVGGMTFSNHRRVLTAAWYVDDRLHRHFFDEWARSIHE
DLARQLPGQEIAITSITRDESRAIVHASSDLSPGSIWTYDIASRHLSRLTELMPWLDPAD
MAHMEPIHFAARDGLRINGYLTLPAGIELGQKLERPLPLIVNPHGGPWARDSWGFNPEAQ
LLANRGYAVLQLNFRGSTGYGRAFWEASFGQWGKSMQDDIDDGIDWLVGQGLADPARVGI
YGASYGGYAVLAGVAFTPTRYAAAVDYVGVSNLFTLLESLPPYWKPMLDMMYEMIGNPQT
EAGKQALHDASPLFFVDRIVTPLFVAQGANDPRVKQAESDQIVSALRERGIDVKYMLKDN
EGHGFHNEENQFEFYEAMEAFLAQHLGGRSGA