Protein Info for BPHYT_RS33285 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 263 (182 residues), 38.7 bits, see alignment E=4.5e-14

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_6726)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9B9 at UniProt or InterPro

Protein Sequence (269 amino acids)

>BPHYT_RS33285 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MRSNRWMRVAVLTVYILFALIPLYWMLSISLRTNEETMSAFAIWPHHVTFDNYKVIFTDP
SWYWGYINSIIYVLMNTVMSVLVALPAAYAFSRYRFLGDKHMFFWLLTNRMTPPAVFLLP
FFQLYSSVGLMDTYIAVALAHMLFNVPLAVWILEGFMSGVPREIDETAYIDGYTFPAFFI
KIFLPLIKSGVGVTAFFCFMFSWVELLLARTLTTVNAKPIAAVMTRTVSAAGMDWGVLSA
AGVLTIVPGALVIYFVRNYIAKGFAMGRV