Protein Info for BPHYT_RS33250 in Burkholderia phytofirmans PsJN

Annotation: diguanylate phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1037 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 305 to 328 (24 residues), see Phobius details PF03924: CHASE" amino acids 74 to 260 (187 residues), 203.7 bits, see alignment E=8.8e-64 TIGR00229: PAS domain S-box protein" amino acids 346 to 473 (128 residues), 52.9 bits, see alignment E=3.9e-18 amino acids 480 to 593 (114 residues), 67.2 bits, see alignment E=1.5e-22 PF08448: PAS_4" amino acids 366 to 468 (103 residues), 35 bits, see alignment E=5.3e-12 PF13426: PAS_9" amino acids 374 to 465 (92 residues), 33.9 bits, see alignment E=1.1e-11 amino acids 484 to 586 (103 residues), 58.3 bits, see alignment E=2.9e-19 PF08447: PAS_3" amino acids 375 to 454 (80 residues), 46.7 bits, see alignment 1.1e-15 amino acids 496 to 581 (86 residues), 28 bits, see alignment E=7.8e-10 PF00989: PAS" amino acids 484 to 584 (101 residues), 46.4 bits, see alignment E=1.3e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 596 to 763 (168 residues), 141.7 bits, see alignment E=1.9e-45 PF00990: GGDEF" amino acids 598 to 759 (162 residues), 153.8 bits, see alignment E=1.3e-48 PF00563: EAL" amino acids 782 to 1014 (233 residues), 247.8 bits, see alignment E=3.4e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6719)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9B2 at UniProt or InterPro

Protein Sequence (1037 amino acids)

>BPHYT_RS33250 diguanylate phosphodiesterase (Burkholderia phytofirmans PsJN)
MNWARLVLIPFLVLSAALSVTWMLWDHERQAARHELLSQFNYSLGDAVSRIEQRMGTYEL
LLRGVQSLFAATGEIDRARFRDYVGTLNLDANFSGIQAIGIVAWVPATQMVEHIASMRRQ
GVPDYAIEPKGSREDYAPIIQREPFIGINRAAPGFDAWADPVRRRALEQARDSGMATLSG
KVRLSVDSGNARPGFIMYLPIYARGQPQDSVAQRRAHLVGWVYASFRMHDVIASLYGEQP
PGLTIAIYDGVETSAAALLHKTPEAPGHHRVTDMAANEYLVVGGHDWTLSMNAQDDFKAR
FGRNAALPIASTGTGLSLLLALLTWLMMTGRGRAMRLASAMTKELRENEEKFRAIADCTV
NWEIWWGTDGKPRWINSAVEAYIGYTVDECMALPDFAGTVIYPADIPRVAPEFQKALQGL
RGDDLEFRCVRKDGSLMWLSASWVPITDSKGEFIGFRTSGRDITERKQVEAELRIAAVAF
DSMEPMMITDASATILRVNSAFTECTGYTAEEIVGQTPRVLRSGRHDDAFFQEMWEEIHS
AGGWQGEVWDRRKNGEVYPKWLTISAVMSDNGTVSHYVGTHHDITERKIAEERIKELAFF
DALTRLPNRTLLLDRLRQAITASARNEACGALLFIDLDHFKTLNDTLGHDKGDLLLQQVA
RRLADSVLESDTVARVGGDEFVVVLGNLHKNRQEAANQTEAVGERILAVLGSPYHLGKIE
YRTSASIGATVFRGHQASIDELLKQADLAMYKSKERGRNAVRFFDPDMQTVVVQRAALEA
GLRNAIEDNQFLLHYQAQVVGTRVTGAEALVRWQHPQRGIVPPAEFIPLAEETGLIVALG
SWVLEAACAQLARWAARPDMAHLTIAVNVSVQQFRKADFVDNVLTIIGRTGARPDRLKLE
LTESVLVDNVQDIIEKMSALKAKGIVFALDDFGIGYSSLSYLKRLPLDQLKIDRSFVRDV
LVDSNDAVIARTIVALARSLGLGVIAEGVETEAQRDFLAAAGCYAYQGYYFCRPLPIEDF
EALLNNVETRQCVAERT