Protein Info for BPHYT_RS33180 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 171 to 186 (16 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 376 to 394 (19 residues), see Phobius details PF14264: Glucos_trans_II" amino acids 47 to 363 (317 residues), 46.3 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6704)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T997 at UniProt or InterPro

Protein Sequence (504 amino acids)

>BPHYT_RS33180 hypothetical protein (Burkholderia phytofirmans PsJN)
MLTNTTSSIAGRAPLNRAISTQKDIIAIWILLALITSIVVLPNVWIYSIDDIAIRNAVDP
LQYIVVDQGSNGRFMFSATAALLRTVGFGPLEFLSISLISIIVGLPALFIAIIHAARLRL
NIAEIVIPFCAFVLCGCMFDVYQFSYASIQVGAGSLLAALALYVASSERPIAIRLIVLTA
SGWLATGFYQIYPYLLTSAAVAIVLLRAADGKLDSIDIRKIVLFALTVAISVVFSIFLYL
ATNKFMKAMNFESMANYPLRPFGIGFARANVTHYLDSIKEILNPNSPLYGYFYSKFYLLG
VFAALIIIGVCKMSSVRNISVIMLSLTITVLMLPNPTNILLQVYWPTPRSLSPVSLIIGA
LFIGGPLQIRSEKYKNIFTALLVFCVSCQALLYMDMTNIRRDQQDLDFQFAKKLIDEAEQ
NSASNTPITIKTSMSWRDNTLVHQRSFDYAGSLFSAEWSTRALFGYLSGRRVTWLPASEN
DCAGVNRNIATLFKDNTLITCSTK