Protein Info for BPHYT_RS32980 in Burkholderia phytofirmans PsJN

Annotation: carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details PF00135: COesterase" amino acids 55 to 388 (334 residues), 310.4 bits, see alignment E=4.4e-96 amino acids 425 to 537 (113 residues), 67 bits, see alignment E=2.6e-22 PF20434: BD-FAE" amino acids 132 to 246 (115 residues), 39.5 bits, see alignment E=7.1e-14 PF07859: Abhydrolase_3" amino acids 211 to 254 (44 residues), 27.3 bits, see alignment 4.4e-10

Best Hits

KEGG orthology group: K03927, carboxylesterase type B [EC: 3.1.1.1] (inferred from 100% identity to bpy:Bphyt_6663)

Predicted SEED Role

"Para-nitrobenzyl esterase (EC 3.1.1.-)" (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.1.1

Use Curated BLAST to search for 3.1.1.- or 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T959 at UniProt or InterPro

Protein Sequence (569 amino acids)

>BPHYT_RS32980 carboxylesterase (Burkholderia phytofirmans PsJN)
MIARRHNVLEKTEPRAVLKQDASRHLPKLFVSSTLAVMLAACGGGGSAVTSDPTIAVTAD
GAVKGSASDGVVAFKGIPFAAPPVGALRWRPPQPVTAWSGVRQTTSFVHDCMQTSGANSG
LTVTPSEDCLYLNVWRPQNSNGKNLPVMVWIYGGAYVTGGTSMPTYDGTQFANQGVVIVT
MNYRLGRFGFFAHPALTAAAAQSGETLANYGYMDQIAALKWVQRNIANFGGDPTNVTLFG
ESAGGEAVHNLLTSPQATGLFAKAIIESGNGRVNQYYGRTLSRNAKTVGDSAEEQGSAFA
TGYGIAGSDASSLQALRALSASQVLDGLDTSTLNSAHSLATFSGSSIIDGKLVVDEPENQ
YKAGQFAKVPLLLGVNNADLGFATRGLTTKEQAYAIFGPQNLGAAAAAFDPTGTASVSTV
ENQIARVITMDEPARFVARTFIAQGVPTYLYRFSYVAQSIRSKVSGATHAAEIPYVFDTL
PATYGAAVTSQDEQVAHSMIAYWTAFARTGSPSGAGLTAWPRYDAGLDNQLEFTSAGTLQ
INQPNPLKAQIDLVEPLNDANQTVNRQYQ