Protein Info for BPHYT_RS32970 in Burkholderia phytofirmans PsJN

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF13409: GST_N_2" amino acids 15 to 81 (67 residues), 47.3 bits, see alignment E=5.1e-16 PF13417: GST_N_3" amino acids 15 to 85 (71 residues), 52.2 bits, see alignment E=1.2e-17 PF02798: GST_N" amino acids 16 to 80 (65 residues), 39.5 bits, see alignment E=1.1e-13 PF14834: GST_C_4" amino acids 94 to 205 (112 residues), 157.6 bits, see alignment E=3.2e-50

Best Hits

Swiss-Prot: 51% identical to YFCF_ECOLI: Glutathione S-transferase YfcF (yfcF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6662)

MetaCyc: 51% identical to glutathione S-transferase YfcF (Escherichia coli K-12 substr. MG1655)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Probable glutathione S-transferase (EC 2.5.1.18), YfcF homolog" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T958 at UniProt or InterPro

Protein Sequence (210 amino acids)

>BPHYT_RS32970 glutathione S-transferase (Burkholderia phytofirmans PsJN)
MFEGSLRLYADAQFASPYAMSVFVALQEKQLPFELFAVDLGTDANHEESYAAKSLTQRVP
TLTHGAFALSESSAITEYLDDTFAETLVYPQDRHLRARARQLQAWLRSDLMPIRQERSTE
VVFYKRQAPPFSAKAQLAVQKLYFAADRLLSNDASNLFGDWCIADTDLALMLNRLVMNGD
DVPAKLASYAAHQWERASVQQWVTLDRPRL