Protein Info for BPHYT_RS32900 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 117 to 117 (1 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 22 to 228 (207 residues), 57.6 bits, see alignment E=1.1e-19 PF07690: MFS_1" amino acids 38 to 371 (334 residues), 90.6 bits, see alignment E=9.6e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6648)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T944 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BPHYT_RS32900 MFS transporter (Burkholderia phytofirmans PsJN)
MASADLAAVPRQPAIKRKWKTVILASLGGSLEIYDFIIYGIFAREIARQFFPATDPLASL
ISTFSVFAIGYVSRPLGGIVLSSLGDRYGRRVIFLVSVLAMSAATIGIGLIPGYASIGVL
APVLLVLLRLAQGFFLAGELPCSITYVVEEIPARASLVSGLVILCLNSGVLTATLISLAL
HALLSAADVLAYGWRIAFIFGGVIGLVSYWLRTSLEESNEYQRLKSHKVKRPFRKVLSDY
PKQVAIGVGVAGIVNASNSILFIVLPSYLTTVLHYAPTAVSAGQNLGIATMSASLLFFAW
LGDSVPSRHWHRIGSLVMLLGSYPLYRLIAAHEIDPLFAFVVIGVVGGFVNGAYAYLLAD
LFPTNVRFSGIALSLNLATVIFTGITPLVITQLLHHTGALTAPGIFLTGVALIALIAGLF
VGRFGGQLERVTQ