Protein Info for BPHYT_RS32745 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 31 to 231 (201 residues), 80.5 bits, see alignment E=1.3e-26 PF07690: MFS_1" amino acids 67 to 343 (277 residues), 88.8 bits, see alignment E=3.6e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6616)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T912 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BPHYT_RS32745 major facilitator transporter (Burkholderia phytofirmans PsJN)
MSEATFNQRDGASSEADASNGLSPSMVRRAIFASILGNGLEWFDFLIYGYFAKIIAQVFF
PGGSGFVSIMLTLATFAVGFIVRPIGGILLGIYADRAGRRKALSLLIISMAASTLLMGLT
PGYARIGMAAPLLVVLARLLQGLSVGGQFATASAMLVEYAPPHKKMFYGSFNMSAQAFAL
LLSSGVGYLLTTQLTHEQLVAWGWRLPFLFGALAGPFGFYIRHRVAESPEFERLLEHKDR
PPRVTIRQFFRDNGDAAICAMGVIIIGAATNYVWHSYLSVYVERQLHLPLSTALLGAFVS
GVLNLFLFPLSGKLADRYGAYRLFYPIVIAWMVCVYPLYHFVVTNPTPGYLFIAQMIATL
FLAAMSGAHPGMLATLFPVRSRSAGVALSYNIAVTLFGGMAPLTITGLTRVTGSSLTPAF
YLIFAGFVSLAMVYFTRAGLISGDVAARSATH