Protein Info for BPHYT_RS32715 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 848 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03361: type VI secretion system Vgr family protein" amino acids 35 to 565 (531 residues), 306.6 bits, see alignment E=3.1e-95 TIGR01646: Rhs element Vgr protein" amino acids 40 to 567 (528 residues), 289.4 bits, see alignment E=5.9e-90 PF05954: Phage_GPD" amino acids 47 to 393 (347 residues), 175 bits, see alignment E=4.6e-55 PF04717: Phage_base_V" amino acids 452 to 515 (64 residues), 25.4 bits, see alignment 3e-09 PF13296: T6SS_Vgr" amino acids 544 to 648 (105 residues), 99 bits, see alignment E=3.5e-32 PF10106: DUF2345" amino acids 681 to 830 (150 residues), 175.4 bits, see alignment E=1.4e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T906 at UniProt or InterPro

Protein Sequence (848 amino acids)

>BPHYT_RS32715 hypothetical protein (Burkholderia phytofirmans PsJN)
MTRWTAQTRTLTFSGAALPEIIGVDYRSRQCIEIREPMLTVRRLRGREAVGELFEYVVET
EVENPDFLQDPESVAQLDLAAIVGTSGTVAIQVAGIGTFRAGAKGDTGRANVGADTRYIN
GEIVSARIRCVEDRAAVFEFVLRPFVWRATLNCDSRIFHGTVIEVLEEVLQPYVGTVEWR
IGGMWPGKGYPPRDMIRQAWEPDWQFASFLMEEFGLFYWFEHRDDFHSLVISDLLSGFRP
HGVAYETLRYHTGSRIDEEHISELSIAYTLTPGKATVNDHNYAEPRLAKSLVPNRETCED
TRGTASRDIEIYEPADFAQPEARRTAADANDERGEGQHLARVKLQSRRCQSLRATGRGRL
QALQPGRTFTLAGYPQERANCEYIVLSCDLDMTEVGTSSGPTRQYTVNTEFELQPANEYF
RLPQVTPRPRIDGYEYAVVVAPQDKEMYIDYRNRLRIQFDWDRQANLDGATSIWVRVMTQ
WQGGELGVVAPGRAGQMVLVSHVHGDPDRPVVAGFVVDKFNMPPWELPANAALSGMRSKS
LGYGLRSNHLALDDTPGKMQAQLASDQANSRFVAGFNTRIDGTKGRTEARGEGIEIATDA
HLVGRGNQGVLLTSEARVGASAPVKDMGETVARLTQARQQHEDLSRLAIQHNAQTMDASQ
GDATSMIKAQNEAIRGGQKTEENPSPEMTRPDVVLASAAGIATTAADSTHMASVKDHAIT
AGRDVSVSSGRSLFASVRGAISLFAYQLGLKLIAAKGKVDIQAQSDQMALAALNDLTISS
TDGRIVLTAAKEIWLGAGGSYIQIDGSGIINGSPGAILERGATWDVPGPDTQRVRVPDLP
GDKIHSAQ