Protein Info for BPHYT_RS32465 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 64 (15 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 212 to 222 (11 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 315 (27 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details PF03773: ArsP_1" amino acids 75 to 345 (271 residues), 92.3 bits, see alignment E=1.7e-30

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to bpy:Bphyt_6565)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBC2 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BPHYT_RS32465 membrane protein (Burkholderia phytofirmans PsJN)
MQSTLRQPRVALGWIVFLLIAVVGLFYVKWFPYYNRAFVAASQHSIGKSILMGTSASAPA
ASWQSAIDYALAYGKAIWQAMVLGLLLGSAVQALIPPQWVARALGRTDFSSVVKGGLLSL
PGMMCTCCAAPVVAGLRARQAAPGAAIAFWLGNTALNPATLIFMGFVLGWQWMGLRLALG
IVMVFGLGYLVNRMVTPKEAEASREAMAQLVAVDVPGTAFARWVKILGTMTLRLVPEYIV
LVLILGAARTWLFPHVGPEIDNSLLWIIALAIAGTLFVIPTAGEVPIIQAMLSFGMAAGP
AGALLMTLPLISVPSMAMLGRSFPRRVLTVVALAVVVCGVVSGLLAVALGF